PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0050.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LFY
Protein Properties Length: 423aa    MW: 46713.3 Da    PI: 6.9386
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0050.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY6167.1e-18813921386
               FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddl 89 
                           mdpe f++ lf+w+p+ a++++p  + +  +++  p++ ++aa  ++l +le lf ayG+r++t+akiaelGft+stLv+mkdeel+++
  Bostr.26833s0050.1.p   1 MDPEGFTSGLFRWNPARAMVQAPPPVPPPPQQQ--PATPQTAAFGMRLGGLEGLFGAYGIRFYTAAKIAELGFTASTLVGMKDEELEEM 87 
                           9*************8777766665665554433..33356777788889**************************************** PP

               FLO_LFY  90 mkslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll....sedeetaldalsqe....glseepvqeeke.aags.gge 166
                           m+sls+ifr++llvGeryGikaavraerrrl+e  e+++++rr+ll     + +++aldalsqe    glseepvq++ + +ag+ gg+
  Bostr.26833s0050.1.p  88 MNSLSHIFRWELLVGERYGIKAAVRAERRRLQEeeEDESSRRRHLLlsagDSGTHHALDALSQEddwtGLSEEPVQQQDQnSAGNnGGG 176
                           *******************************9855556678888777744344556*******988889******99655233331333 PP

               FLO_LFY 167 glgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg.....sgedgeerqrehPfivtepgevargkknGLD 250
                           g g +e+ +a+       kk++   +++rkk   ++ e+d+d +e ed+d+++     +g  g+erqrehPfivtepgevargkknGLD
  Bostr.26833s0050.1.p 177 GGGYWEAGQAK------MKKQQ---QRRRKKPMVASVETDDDVNEGEDDDGMDngnggGGVLGTERQREHPFIVTEPGEVARGKKNGLD 256
                           33344433332......22222...223333333344455555555555554411111445566************************* PP

               FLO_LFY 251 YLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqa 339
                           YLf+LyeqCrefLlqvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLde+asnalrrafkergenvG+wrqa
  Bostr.26833s0050.1.p 257 YLFHLYEQCREFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEDASNALRRAFKERGENVGSWRQA 345
                           ***************************************************************************************** PP

               FLO_LFY 340 cykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                           cykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Bostr.26833s0050.1.p 346 CYKPLVNIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 392
                           *******************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016984.1E-2001391IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPARAMV QAPPPVPPPP QQQPATPQTA AFGMRLGGLE GLFGAYGIRF  60
YTAAKIAELG FTASTLVGMK DEELEEMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEDESSRRR HLLLSAGDSG THHALDALSQ EDDWTGLSEE PVQQQDQNSA GNNGGGGGGY  180
WEAGQAKMKK QQQRRRKKPM VASVETDDDV NEGEDDDGMD NGNGGGGVLG TERQREHPFI  240
VTEPGEVARG KKNGLDYLFH LYEQCREFLL QVQTIAKDRG EKCPTKVTNQ VFRYAKKSGA  300
SYINKPKMRH YVHCYALHCL DEDASNALRR AFKERGENVG SWRQACYKPL VNIACRHGWD  360
IDAVFNAHPR LSIWYVPTKL RQLCHLERNN AVAAAAALVG GISCTGSSTS GRGGCGGDDL  420
RF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1452294221194PROTEIN LEAFY
2vy2_A1e-1452294221194PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4719320.0DQ471932.1 Brassica juncea cultivar Varuna LEAFY transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010457875.10.0PREDICTED: protein LEAFY isoform X1
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLQ3ZLS70.0Q3ZLS7_BOEST; LEAFY protein (Fragment)
STRINGAT5G61850.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)